PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462898000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 217aa    MW: 23503.9 Da    PI: 4.6549
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462898000genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-143980346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     + ++ E+e ++ + + lG++ W+tIa++m+ gRt++++k++w++
        462898000 39 PISKREEEVIISLQQSLGNR-WSTIAARMP-GRTDNEIKNYWNS 80
                     56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.55E-201787IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-51730IPR009057Homeodomain-like
PROSITE profilePS500904.3331831IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.5E-243186IPR009057Homeodomain-like
PROSITE profilePS5129421.6563286IPR017930Myb domain
SMARTSM007171.6E-123684IPR001005SANT/Myb domain
CDDcd001677.70E-103979No hitNo description
PfamPF002491.1E-113980IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MVRKPSHADA GTGERLRRSG KSCRLRWMNY LRPDLKKEPI SKREEEVIIS LQQSLGNRWS  60
TIAARMPGRT DNEIKNYWNS RIRKRLNAAA KAGGADDNAA EEPAPAAAGK EEESTNNEAT  120
TAASLPIPAR FPVFACQLLD GGGSDGGDGA VSSSTTTQQQ NSGSEESEAS VGDSNMIHDF  180
FSFDEIDYPS DLLMDVPGVM DAWESVLYSA NSMGSIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-19188840110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715592e-83EU971559.1 Zea mays clone 367166 anthocyanin regulatory C1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.16e-92PREDICTED: transcription factor MYB82-like
TrEMBLK3XL226e-92K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m2e-91(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-31myb domain protein 46